PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr013295.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family CO-like
Protein Properties Length: 454aa    MW: 50075.5 Da    PI: 5.0561
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr013295.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box292.2e-091660341
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                 +r C+ + +k+++++C  ++ +lCe C +  H+       H++v 
  Pbr013295.1 16 ARACDSCIKKRARWYCAADDAFLCEACDSDVHSAnqlarrHERVL 60
                 578*****************************6578888898875 PP

2CCT68.32.1e-23398441144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  Pbr013295.1 398 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS 441
                  9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.5371461IPR000315B-box-type zinc finger
SMARTSM003362.6E-111461IPR000315B-box-type zinc finger
PfamPF006433.3E-71660IPR000315B-box-type zinc finger
CDDcd000213.30E-91761No hitNo description
PROSITE profilePS5101716.083398440IPR010402CCT domain
PfamPF062036.1E-18398440IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MNSSKKVAHA VGGKTARACD SCIKKRARWY CAADDAFLCE ACDSDVHSAN QLARRHERVL  60
LKTASSLKPS NKDDRTTAVS KTSAAPSWHR GFTRKPRTPR GGKSMTHHGK SKEGIRNLFP  120
QVPEVGGDDN NSYDEENEED QQLLYRVPIF DPSVAELCSN SGNSSEDAAA NYEANNLSTV  180
SDNVGSQSKA VSSLPNCNGH DGFLLPSDMD LAEFAADVDS LLGRGLNDDQ CIGMEGLGLR  240
DCKEKESKGR VKLEEDDDQD GIDGVDFMGC QLGESEIDMM KEPFVLNFED YDDSPASCGE  300
QDDKMIVGID SNCTEDHEHE EADEDAIDNS KKRKTILRLD YEAVITAWDG SPWTSGDRPD  360
FDSECLPDYM GVCGPGLHYP YGDLNGIGVH PAMVDGGREA RVSRYREKRR TRLFSKKIRY  420
EVRKLNAEKR PRMKGRFVKR SSFAGSAFPV LAK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1408424RRTRLFSKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009356747.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 6-like
TrEMBLM5XB520.0M5XB52_PRUPE; Uncharacterized protein
STRINGVIT_01s0011g03520.t011e-164(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68520.19e-89B-box type zinc finger protein with CCT domain